PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10025227m
Common NameCARUB_v10025227mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 486aa    MW: 54353.2 Da    PI: 5.5568
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10025227mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.2e-16855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l ++v+++G g+W+++ +  g+ R++k+c++rw ++l
  Carubv10025227m  8 KGPWTATEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCRLRWANHL 55
                     79******************************99**********9986 PP

2Myb_DNA-binding51.32.6e-1661104146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E++++++++++lG++ W++ a+ ++ gRt++++k++w++
  Carubv10025227m  61 KGSFTPDEEKIIIELHAKLGNK-WARMASQLP-GRTDNEIKNYWNT 104
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.57355IPR017930Myb domain
SuperFamilySSF466891.12E-295102IPR009057Homeodomain-like
SMARTSM007172.9E-14757IPR001005SANT/Myb domain
PfamPF002491.1E-14855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-23962IPR009057Homeodomain-like
CDDcd001675.90E-111055No hitNo description
PROSITE profilePS5129425.32256110IPR017930Myb domain
SMARTSM007174.7E-1660108IPR001005SANT/Myb domain
PfamPF002492.6E-1561104IPR001005SANT/Myb domain
CDDcd001671.35E-1163104No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2563109IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MEARGLKKGP WTATEDAILT EYVRKHGEGN WNAVQKNSGL LRCGKSCRLR WANHLRPNLK  60
KGSFTPDEEK IIIELHAKLG NKWARMASQL PGRTDNEIKN YWNTRMKRRQ RAGLPLYPHE  120
IHQHHQEIDN DDDEFEFDLS SFQFQNQDLH SQQNMIQYTN SSNTSSSSSS FSSSSSQPSK  180
RMRPDPLAAS TNPGLMNPIP DSSMNFQMFS LYNNSLDNDS NQFGFSLPLS SSSSSNELCN  240
PNHSILEFIS ENSDTDNNIK REIDALSYSS LLMGDLEMRP RSFPLGLDNT VLELPSNQIH  300
SHSFSSNPIL DNGVHLEPPA GNSGLLDALL EESHALSRGG LFKDVRVSSS SDRCKVQDER  360
MKMEFEDRLT NHLNSSHPSS FGTNPNIHKY NEPPMVKATV DDDDDDLLMS LLNSFPSTTT  420
PLPDWYRMTE IQNEASYLAP PSGSILMGNY QGSSRVEPAT VPPSSSVDPT ASLGSCYWSN  480
MPRIC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-3161095107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4119700.0AF411970.1 Arabidopsis thaliana putative transcription factor MYB101 (MYB101) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296077.10.0hypothetical protein CARUB_v10025227mg
TrEMBLR0HUA20.0R0HUA2_9BRAS; Uncharacterized protein
STRINGAT2G32460.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51002747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.10.0myb domain protein 101